Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich transmembrane protein 1 (PRRT1)

This Recombinant Human Proline-rich transmembrane protein 1 (PRRT1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 1

UniProt

Q99946

Expression Region

1-306

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPAPPPQAAPSSHHHHHHHYHQSGTATLPRLG AGGLASSAATAQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEG PLPPPPPAAAAPPPPAPAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVP VYPVGTPYAGGTPGGTGVTSTLPPPPQGPGLALLEPRRPPHDYMPIAVLTTICCFWPTGI IAIFKAVQVRTALARGDMVSAEIASREARNFSFISLAVGIAAMVLCTILTVVIIIAAQHH ENYWDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM18 Rabbit Polyclonal Antibody
TA368585 100 µL

TMEM18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APPBP1 (NAE1) Rabbit Polyclonal Antibody
TA378911 100 µL

APPBP1 (NAE1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBE3B Mouse Monoclonal Antibody [Clone ID: OTI4E4]
CF806667 100 µg

UBE3B Mouse Monoclonal Antibody [Clone ID: OTI4E4]

Sign In for Pricing
View Details
Rat IL-17A (Interleukin 17A) ELISA Kit
E-EL-R0566-01 24 Tests

Rat IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details
Rat IL-17A (Interleukin 17A) ELISA Kit
E-EL-R0566-02 48 Tests

Rat IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details
Rat IL-17A (Interleukin 17A) ELISA Kit
E-EL-R0566-03 96 Tests

Rat IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details