Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter pomeroyi Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Silicibacter pomeroyi Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q5LNI0

Expression Region

1-306

Origin

Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTALLLGFAMLLDAALGEPEWLWSRLRHPAVLIGDIISVLDDELNEGGHRRLKGVAVTA ILAVGALSVGALLSLLGPVAEVLICAILLAQKSLAGHVADVADALRLSLPEARRSVARIV SRDTATMSEPQVARAAIESAAENLSDGVIAPAFWFLVGGLPGLLLYKTINTADSMVGYMN ERYAQFGWAAARLDDLLNLIPARLTCGMIVLLSNGWRHWRGIVEDAQRHISPNAGWPEAA MARALNIALAGPRSYHGEIRHLAWVNEEGRKEIGPREIERAVTLLWQVWALALGLTLTLV ALAAIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTBP1 Recombinant Mouse Monoclonal Antibody [5C1-R]
HA601197 100 µL

PTBP1 Recombinant Mouse Monoclonal Antibody [5C1-R]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102I-02 100 Tests

PE/Cyanine5.5 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
NKCC1 (SLC12A2) (NM_001046) Human Over-expression Lysate
LC420759 20 µg

NKCC1 (SLC12A2) (NM_001046) Human Over-expression Lysate

Sign In for Pricing
View Details
ROS Brite™ HPF *Optimized for Detecting Reactive Oxygen Species (ROS) *
16051-AAT 1 mg

ROS Brite™ HPF *Optimized for Detecting Reactive Oxygen Species (ROS) *

Sign In for Pricing
View Details