Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R335 (MIMI_R335)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R335 (MIMI_R335) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Uncharacterized protein R335

UniProt

Q5UQT2

Expression Region

1-306

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNNYHTQINRPNMLNEIAANNNLLNNKNNQTNQLNNNQYNNQYNNQNNNQNYPQNYPQN SQQNFQQNSQQNHQQNYQQNYPQKFPHQQNNITEDLVDIELSDSKESGSEYPQSVQQTHQ QPIQNNPSIPNNQPNQINQYNQQPNQYNHQQPNQFTQNQPNQPNQPNQHNQYSQHNQPNQ SNQPNQYNQNNQFAQPNQYNQSGQLNHTNKINKQIQKQLDKNQPEKIPSKPEKNQKQSHK PKLPPTMQHGPLPIHGMPIQHMPPQLPMQTEYCKKSNSLFDYIIIPIALVLVFLFLVHPK TFQNNW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKB epsilon (NFKBIE) Mouse Monoclonal Antibody [Clone ID: OTI6H8]
CF810713 100 µg

IKB epsilon (NFKBIE) Mouse Monoclonal Antibody [Clone ID: OTI6H8]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Purified Antibody To Human Lambda Light Chain,  40nm
GAF-008-40 1 mL

Colloidal Gold Conjugated Goat Purified Antibody To Human Lambda Light Chain, 40nm

Sign In for Pricing
View Details
Recombinant Human DLL4 Protein (Fc Tag)
PKSH031806-01 50 µg

Recombinant Human DLL4 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human DLL4 Protein (Fc Tag)
PKSH031806-02 500 µg

Recombinant Human DLL4 Protein (Fc Tag)

Sign In for Pricing
View Details
Porcine GM-CSF Antibody Pair Set
E-KAB-0622 50 µL & 100 µg

Porcine GM-CSF Antibody Pair Set

Sign In for Pricing
View Details
RNF98 (TRIM36) Human Gene Knockout Kit (CRISPR)
KN416219 1 Kit

RNF98 (TRIM36) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details