Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R335 (MIMI_R335)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R335 (MIMI_R335) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Uncharacterized protein R335

UniProt

Q5UQT2

Expression Region

1-306

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNNYHTQINRPNMLNEIAANNNLLNNKNNQTNQLNNNQYNNQYNNQNNNQNYPQNYPQN SQQNFQQNSQQNHQQNYQQNYPQKFPHQQNNITEDLVDIELSDSKESGSEYPQSVQQTHQ QPIQNNPSIPNNQPNQINQYNQQPNQYNHQQPNQFTQNQPNQPNQPNQHNQYSQHNQPNQ SNQPNQYNQNNQFAQPNQYNQSGQLNHTNKINKQIQKQLDKNQPEKIPSKPEKNQKQSHK PKLPPTMQHGPLPIHGMPIQHMPPQLPMQTEYCKKSNSLFDYIIIPIALVLVFLFLVHPK TFQNNW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELLDATA DNAstormTM 2.0 FFPE DNA Extraction Kit, 50 preps
#CD507 1 Kit

CELLDATA DNAstormTM 2.0 FFPE DNA Extraction Kit, 50 preps

Sign In for Pricing
View Details
7-Coumaryl Triflate
TRC-C756450-250MG 250 mg

7-Coumaryl Triflate

Sign In for Pricing
View Details
MLH1 (MutL Homolog 1) (MLH1/1324), 1mg/mL
BNUM1324-50 1x 50 µL

MLH1 (MutL Homolog 1) (MLH1/1324), 1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Skin
CP615444 150 µg

Tissue Protein Lysate, Skin

Sign In for Pricing
View Details
Fas Ligand (FASLG) Mouse Monoclonal Antibody [Clone ID: B-R17]
AM31198PU-N 2 mL (200 Tests)

Fas Ligand (FASLG) Mouse Monoclonal Antibody [Clone ID: B-R17]

Sign In for Pricing
View Details
SC5DL (SC5D) Human Gene Knockout Kit (CRISPR)
KN400627 1 Kit

SC5DL (SC5D) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details