Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Walleye dermal sarcoma virus ORF-B protein

This Recombinant Walleye dermal sarcoma virus ORF-B protein spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

ORF-B protein

UniProt

Q88940

Expression Region

1-306

Origin

Walleye dermal sarcoma virus (WDSV)

Field of Research

Infectious Disease & Virology; Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSDSDSSDEELSRIITDIDESPQDIQQSLHLRAGVSPEARVPPGGLTQEEWTIDYFSTY HTPLLNPGIPHELTQRCTDYTASILRRASAKMIQWDYVFYLLPRVWIMFPFIAREGLSHL THLLTLTTSVLSATSLVFGWDLTVIELCNEMNIQGVYLPEVIEWLAQFSFLFTHVTLIVV SDGMMDLLLMFPMDIEEQPLAINIALHALQTSYTIMTPILFASPLLRIISCVLYACGHCP SARMLYAYTIMNRYTGESIAEMHTGFRCFRDQMIAYDMEFTNFLRDLTEEETPVLEITEP EPSPTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSG5 (NM_001130014) Human Over-expression Lysate
LY427103 100 µg

PSG5 (NM_001130014) Human Over-expression Lysate

Sign In for Pricing
View Details
PARP9 (NM_001146102) Human Over-expression Lysate
LY431624 100 µg

PARP9 (NM_001146102) Human Over-expression Lysate

Sign In for Pricing
View Details
CARD9 (NM_052813) Human Recombinant Protein
TP315899L 1 mg

CARD9 (NM_052813) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse ACTα2 (Actin Alpha 2, Smooth Muscle) ELISA Kit
E-EL-M2434-01 24 Tests

Mouse ACTα2 (Actin Alpha 2, Smooth Muscle) ELISA Kit

Sign In for Pricing
View Details
Mouse ACTα2 (Actin Alpha 2, Smooth Muscle) ELISA Kit
E-EL-M2434-02 48 Tests

Mouse ACTα2 (Actin Alpha 2, Smooth Muscle) ELISA Kit

Sign In for Pricing
View Details
Mouse ACTα2 (Actin Alpha 2, Smooth Muscle) ELISA Kit
E-EL-M2434-03 96 Tests

Mouse ACTα2 (Actin Alpha 2, Smooth Muscle) ELISA Kit

Sign In for Pricing
View Details