Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Walleye dermal sarcoma virus ORF-B protein

This Recombinant Walleye dermal sarcoma virus ORF-B protein spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

ORF-B protein

UniProt

Q88940

Expression Region

1-306

Origin

Walleye dermal sarcoma virus (WDSV)

Field of Research

Infectious Disease & Virology; Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSDSDSSDEELSRIITDIDESPQDIQQSLHLRAGVSPEARVPPGGLTQEEWTIDYFSTY HTPLLNPGIPHELTQRCTDYTASILRRASAKMIQWDYVFYLLPRVWIMFPFIAREGLSHL THLLTLTTSVLSATSLVFGWDLTVIELCNEMNIQGVYLPEVIEWLAQFSFLFTHVTLIVV SDGMMDLLLMFPMDIEEQPLAINIALHALQTSYTIMTPILFASPLLRIISCVLYACGHCP SARMLYAYTIMNRYTGESIAEMHTGFRCFRDQMIAYDMEFTNFLRDLTEEETPVLEITEP EPSPTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP9 (NM_001080157) Human Over-expression Lysate
LY421604 100 µg

ARHGAP9 (NM_001080157) Human Over-expression Lysate

Sign In for Pricing
View Details
BAP1 (NM_004656) Human Over-expression Lysate
LC401476 20 µg

BAP1 (NM_004656) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc25a53 Mouse Gene Knockout Kit (CRISPR)
KN515999 1 Kit

Slc25a53 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
XAGE2 (NM_130777) Human Recombinant Protein
TP309757 20 µg

XAGE2 (NM_130777) Human Recombinant Protein

Sign In for Pricing
View Details
Mortality Factor 4 like 2 (MORF4L2) (NM_012286) Human Over-expression Lysate
LC402188 20 µg

Mortality Factor 4 like 2 (MORF4L2) (NM_012286) Human Over-expression Lysate

Sign In for Pricing
View Details
Aluminum Phthalocyanine Chloride (Technical Grade)
TRC-A576023-50MG 50 mg

Aluminum Phthalocyanine Chloride (Technical Grade)

Sign In for Pricing
View Details