Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ubiquitin-associated domain-containing protein 2 (Ubac2)

This Recombinant Mouse Ubiquitin-associated domain-containing protein 2 (Ubac2) spans the amino acid sequence from region 40-345.

Product Specifications

Product Name Alternative

Ubiquitin-associated domain-containing protein 2, UBA domain-containing protein 2, Phosphoglycerate dehydrogenase-like protein 1

UniProt

Q8R1K1

Expression Region

40-345

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FFVYDLHAVKHDLQIWRLICGRIICLDLKDAFCSGLLIYNFRIFERRYGSRKFASFLLGS WVLSALFDFILVEAVQYSLGVTVASNLPSGFLAPVFALFVPFHCSIPRVQVAQILGPLSI TNKTLIYILGLQLFTSGSYIWIVAMSGLISGMCYDRKVLQVHQVLRIPGRMAEFFSWALE PIFSSSEPTSEARVGMGATVDIQRQQRMEQLDRQLMLSQFAQVRRQRQQQGGMINWNRLF PPLRQRRNINYQDGPRSEQRASPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVAT NFLLQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homeobox Protein Hox-A9 (HOXA9) Antibody
abx224372 100 µL

Homeobox Protein Hox-A9 (HOXA9) Antibody

Sign In for Pricing
View Details
Mouse Rims4 ELISA KIT
ELI-35591m 96 Tests

Mouse Rims4 ELISA KIT

Sign In for Pricing
View Details
pDNR-LIB-Fv1 Plasmid
PVT42038 2 µg

pDNR-LIB-Fv1 Plasmid

Sign In for Pricing
View Details
METTL6 siRNA (Mouse)
MBS8202637-01 15 nmol

METTL6 siRNA (Mouse)

Sign In for Pricing
View Details
METTL6 siRNA (Mouse)
MBS8202637-02 30 nmol

METTL6 siRNA (Mouse)

Sign In for Pricing
View Details
METTL6 siRNA (Mouse)
MBS8202637-03 5x 30 nmol

METTL6 siRNA (Mouse)

Sign In for Pricing
View Details