Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ubiquitin-associated domain-containing protein 2 (Ubac2)

This Recombinant Mouse Ubiquitin-associated domain-containing protein 2 (Ubac2) spans the amino acid sequence from region 40-345.

Product Specifications

Product Name Alternative

Ubiquitin-associated domain-containing protein 2, UBA domain-containing protein 2, Phosphoglycerate dehydrogenase-like protein 1

UniProt

Q8R1K1

Expression Region

40-345

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FFVYDLHAVKHDLQIWRLICGRIICLDLKDAFCSGLLIYNFRIFERRYGSRKFASFLLGS WVLSALFDFILVEAVQYSLGVTVASNLPSGFLAPVFALFVPFHCSIPRVQVAQILGPLSI TNKTLIYILGLQLFTSGSYIWIVAMSGLISGMCYDRKVLQVHQVLRIPGRMAEFFSWALE PIFSSSEPTSEARVGMGATVDIQRQQRMEQLDRQLMLSQFAQVRRQRQQQGGMINWNRLF PPLRQRRNINYQDGPRSEQRASPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVAT NFLLQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Berbamine 2mg
A14794-2 2 mg

Berbamine 2mg

Sign In for Pricing
View Details
HOXA6 sgRNA CRISPR Lentivector (Human) (Target 2)
K0981203 1.0 µg DNA

HOXA6 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RGS16 (phospho Tyr168) Polyclonal Antibody
E44H00938 100 µL

RGS16 (phospho Tyr168) Polyclonal Antibody

Sign In for Pricing
View Details
TRIM59 shRNA (h) Lentiviral Particles
sc-78105-V 200 µL

TRIM59 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Phosphorus (P) ICP Standard Solution 10.0 gm/L In H2O Traceable To NIST-10,000 ppm Water
ICP151 00030-01 30 mL

Phosphorus (P) ICP Standard Solution 10.0 gm/L In H2O Traceable To NIST-10,000 ppm Water

Sign In for Pricing
View Details
Phosphorus (P) ICP Standard Solution 10.0 gm/L In H2O Traceable To NIST-10,000 ppm Water
ICP151 00030-02 30 mL

Phosphorus (P) ICP Standard Solution 10.0 gm/L In H2O Traceable To NIST-10,000 ppm Water

Sign In for Pricing
View Details