Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Surfeit locus protein 1 (Surf1)

This Recombinant Mouse Surfeit locus protein 1 (Surf1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Surfeit locus protein 1

UniProt

P09925

Expression Region

1-306

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVMALAVLPRRMTRWSQWAYAGRAQFCAVRRSVFGFSVRSGMVCRPRRCCSSTAETAA AKAEDDSFLQWFLLLIPATAFGLGTWQVQRRKWKLKLIAELESRVMAEPIPLPADPMELK NLEYRPVKVRGHFDHSKELYIMPRTMVDPVREARDAGRLSSTESGAHVVTPFHCSDLGVT ILVNRGFVPRKKVNPETRQKGQVLGEVDLVGIVRLTENRKPFVPENSPERNHWYYRDLEA MAKITGADPIFIDADFHSTAPGGPIGGQTRVTLRNEHMQYILTWYGLCAATSYLWFQKFV RRTPIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Aup1 qPCR Primer Pair
QM10058S 200 Tests

Mouse Aup1 qPCR Primer Pair

Sign In for Pricing
View Details
MARCO (F-3) Alexa Fluor® 594
sc-398053 AF594 200 µg/mL

MARCO (F-3) Alexa Fluor® 594

Sign In for Pricing
View Details
TSPYL5 HDR Plasmid (m)
sc-433680-HDR 20 µg

TSPYL5 HDR Plasmid (m)

Sign In for Pricing
View Details
Lentiviral human SPTAN1 shRNA (UAS) - Lentiviral human SPTAN1 shRNA (UAS, GFP) (25)
GTR15345575 1 Vial

Lentiviral human SPTAN1 shRNA (UAS) - Lentiviral human SPTAN1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Alpha Internexin Recombinant Antibody, Cy5 Conjugated
bsm-54173R-Cy5-01 20 µL

Alpha Internexin Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Alpha Internexin Recombinant Antibody, Cy5 Conjugated
bsm-54173R-Cy5-02 100 µL

Alpha Internexin Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details