Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proline-rich transmembrane protein 1 (Prrt1)

This Recombinant Mouse Proline-rich transmembrane protein 1 (Prrt1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 1, Synapse differentiation-induced protein 4

UniProt

O35449

Expression Region

1-306

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPIPPPQTAPSSHHHHHHHYHQSGTATLPRLG AGGLASAAASAQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEG PLPPPPPAAAAPPPPAPAPTAQAPGFVVPTHAGAVGTLPLGGYVAPGYPLQLQPCTAYVP VYPVGTPYAGGTPGGPGVTSTLPPPPQGPGLALLEPRRPPHDYMPIAVLTTICCFWPTGI IAIFKAVQVRTALARGDLVSAEIASREARNFSFISLAVGIAAMVLCTILTVVIIIAAQHH ENYWDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR18 Recombinant Protein Antigen
NBP1-87573PEP 0.1 mL

GPR18 Recombinant Protein Antigen

Sign In for Pricing
View Details
FANCE Polyclonal Antibody, FITC Conjugated
bs-13142R-FITC 100 µL

FANCE Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Human Nuclear Factor Kappa B2 (NFkB2) ELISA Kit
RD-NFkB2-Hu-96Tests 96 Tests

Human Nuclear Factor Kappa B2 (NFkB2) ELISA Kit

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to ADP Ribosyltransferase 1 (ART1)
MBS2165971-01 0.1 mL

Cy3-Linked Polyclonal Antibody to ADP Ribosyltransferase 1 (ART1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to ADP Ribosyltransferase 1 (ART1)
MBS2165971-02 0.2 mL

Cy3-Linked Polyclonal Antibody to ADP Ribosyltransferase 1 (ART1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to ADP Ribosyltransferase 1 (ART1)
MBS2165971-03 0.5 mL

Cy3-Linked Polyclonal Antibody to ADP Ribosyltransferase 1 (ART1)

Sign In for Pricing
View Details