Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proline-rich transmembrane protein 1 (Prrt1)

This Recombinant Mouse Proline-rich transmembrane protein 1 (Prrt1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 1, Synapse differentiation-induced protein 4

UniProt

O35449

Expression Region

1-306

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPIPPPQTAPSSHHHHHHHYHQSGTATLPRLG AGGLASAAASAQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEG PLPPPPPAAAAPPPPAPAPTAQAPGFVVPTHAGAVGTLPLGGYVAPGYPLQLQPCTAYVP VYPVGTPYAGGTPGGPGVTSTLPPPPQGPGLALLEPRRPPHDYMPIAVLTTICCFWPTGI IAIFKAVQVRTALARGDLVSAEIASREARNFSFISLAVGIAAMVLCTILTVVIIIAAQHH ENYWDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Osteonectin (ON) ELISA Kit
DL-ON-Ra-01 48 Tests

Rat Osteonectin (ON) ELISA Kit

Sign In for Pricing
View Details
Rat Osteonectin (ON) ELISA Kit
DL-ON-Ra-02 96 Tests

Rat Osteonectin (ON) ELISA Kit

Sign In for Pricing
View Details
Botin-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)
MBS2108577-01 0.1 mL

Botin-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)

Sign In for Pricing
View Details
Botin-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)
MBS2108577-02 0.2 mL

Botin-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)

Sign In for Pricing
View Details
Botin-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)
MBS2108577-03 0.5 mL

Botin-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)

Sign In for Pricing
View Details
Botin-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)
MBS2108577-04 1 mL

Botin-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)

Sign In for Pricing
View Details