Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proline-rich transmembrane protein 1 (Prrt1)

This Recombinant Mouse Proline-rich transmembrane protein 1 (Prrt1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 1, Synapse differentiation-induced protein 4

UniProt

O35449

Expression Region

1-306

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPIPPPQTAPSSHHHHHHHYHQSGTATLPRLG AGGLASAAASAQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEG PLPPPPPAAAAPPPPAPAPTAQAPGFVVPTHAGAVGTLPLGGYVAPGYPLQLQPCTAYVP VYPVGTPYAGGTPGGPGVTSTLPPPPQGPGLALLEPRRPPHDYMPIAVLTTICCFWPTGI IAIFKAVQVRTALARGDLVSAEIASREARNFSFISLAVGIAAMVLCTILTVVIIIAAQHH ENYWDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RAB11FIP2 antibody
STJ111661 100 µl

Anti-RAB11FIP2 antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 RBD (Omicron_BQ.1.1) Protein, C-His
EVV00332 100 μg

Recombinant SARS-CoV-2 RBD (Omicron_BQ.1.1) Protein, C-His

Sign In for Pricing
View Details
SLC35G1 Lentiviral Activation Particles (h2)
sc-405723-LAC-2 200 µL

SLC35G1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Substance P polyclonal antibody
MBS566533-01 0.025 mL

Substance P polyclonal antibody

Sign In for Pricing
View Details
Substance P polyclonal antibody
MBS566533-02 0.1 mL

Substance P polyclonal antibody

Sign In for Pricing
View Details
Substance P polyclonal antibody
MBS566533-03 5x 0.1 mL

Substance P polyclonal antibody

Sign In for Pricing
View Details