Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 200B (TMEM200B)

This Recombinant Human Transmembrane protein 200B (TMEM200B) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Transmembrane protein 200B, Transmembrane protein TTMA, Two transmembrane domain-containing family member B

UniProt

Q69YZ2

Expression Region

1-307

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAGSPEECGEVRRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGA LVVLVGMGIAVAGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPV IMGVGLFVFICANTLLYENRDLETRRLRQGVLRAQALRPPDGPGWDCALLPSPGPRSPRA VGCAEPEIWDPSPRRGTSPVPSVRSLRSEPANPRLGLPALLNSYPLKGPGLPPPWGPRTQ TGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRSWPRLDRLSLGGYAKLGGG GDLGARV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 Recombinant Rabbit monoclonal Antibody [SA35-03]
ET1601-8-50UL 50 µL

Cytokeratin 20 Recombinant Rabbit monoclonal Antibody [SA35-03]

Sign In for Pricing
View Details
Stam Mouse Gene Knockout Kit (CRISPR)
KN516827 1 Kit

Stam Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLXNB1 Antibody (Biotin)
KB-8195-01 50 μL

PLXNB1 Antibody (Biotin)

Sign In for Pricing
View Details
PLXNB1 Antibody (Biotin)
KB-8195-02 100 µL

PLXNB1 Antibody (Biotin)

Sign In for Pricing
View Details
PLXNB1 Antibody (Biotin)
KB-8195-03 1 mL

PLXNB1 Antibody (Biotin)

Sign In for Pricing
View Details
CAY 10566
TRC-C227125-5MG 5 mg

CAY 10566

Sign In for Pricing
View Details