Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 200B (TMEM200B)

This Recombinant Human Transmembrane protein 200B (TMEM200B) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Transmembrane protein 200B, Transmembrane protein TTMA, Two transmembrane domain-containing family member B

UniProt

Q69YZ2

Expression Region

1-307

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAGSPEECGEVRRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGA LVVLVGMGIAVAGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPV IMGVGLFVFICANTLLYENRDLETRRLRQGVLRAQALRPPDGPGWDCALLPSPGPRSPRA VGCAEPEIWDPSPRRGTSPVPSVRSLRSEPANPRLGLPALLNSYPLKGPGLPPPWGPRTQ TGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRSWPRLDRLSLGGYAKLGGG GDLGARV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LRRC58 activation kit by CRISPRa
GA114559 1 Kit

Human LRRC58 activation kit by CRISPRa

Sign In for Pricing
View Details
USP44 (NM_001042403) Human Recombinant Protein
TP323740L 1 mg

USP44 (NM_001042403) Human Recombinant Protein

Sign In for Pricing
View Details
PerCP Anti-Human CD8 Antibody[UCHT-4]
AN00427F-01 20 Tests

PerCP Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
PerCP Anti-Human CD8 Antibody[UCHT-4]
AN00427F-02 100 Tests

PerCP Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
PerCP Anti-Human CD8 Antibody[UCHT-4]
AN00427F-03 2x 100 Tests

PerCP Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
FLCN (NM_144997) Human Recombinant Protein
TP320396M 100 µg

FLCN (NM_144997) Human Recombinant Protein

Sign In for Pricing
View Details