Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Surfeit locus protein 1 (surf1)

This Recombinant Xenopus tropicalis Surfeit locus protein 1 (surf1) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Surfeit locus protein 1

UniProt

A4IHH4

Expression Region

1-307

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALPGVTKLLLLPGVRAQLLNTPVRLSHWATPGRCTKSCHAYLQKNLRFCTTRSFSSVSP AAESSEDTVLKWLLLLIPVATFSLGTWQVQRRSWKLKLIQEMEARVSGKPIPLTTDPMEI KELEYRPVKVRGHFDHSKELYILPRTLVDPEREAREAGQLASNTQSGAQVITPFYCSDLG ITILVNRGFVPKKKVNPETRPKGQVSGEVELVGIVRLNETRKPFVPHNDPSRNLWHYKDL SAMAQVVGAEPILIDADRGSTVPGGPIGGQTRVTLRNEHMQYIVTWYGLCAATTYLWCKK FIRKVAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-100 1x 100 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-100 1x 100 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL
BNC682540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details