Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane and coiled-coil domain-containing protein 5B (TMCO5B)

This Recombinant Human Transmembrane and coiled-coil domain-containing protein 5B (TMCO5B) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Transmembrane and coiled-coil domain-containing protein 5B

UniProt

A8MYB1

Expression Region

1-307

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDVGQNPLDDVKNIFFASSLEAVKQNLDCLNSDLEKDLQKLDMENQVLLRKIKEKEETI SSLERKLALSLEEAKEEEELNYVIDEQEESLRELELETAKLEKSNAILSRNVVEVQKKIS GLFTNIGLEEETTKQILEEMKARLQKSTESCAKQEEELAKIESDYQSVSDLCKDQVYYIK KYQEVLRKMKEEKETLLLEKQISKAQDDSSQTVKPGSILADTTQRNMERTTIKKQERRCW YKYFQYLTFMVLVFIRLLAYVIFHLQYINPDLLVDVLPLVLSRGTLESLRKVSHPFLTLA VEEALPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-500 1x 500 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-500 1x 500 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-100 1x 100 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-500 1x 500 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details