Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Methylsterol monooxygenase (ERG25)

This Recombinant Candida albicans Methylsterol monooxygenase (ERG25) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Methylsterol monooxygenase, EC= 1.14.13.72, C-4 methylsterol oxidase

UniProt

O59933

Expression Region

1-308

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSISNVYHDYSSFSNATTFSQVYQNFNQLDNLNVFEKLWGSYYYYMANDLFATGLLFFL THEIFYFGRCLPWAIIDRIPYFRKWKIQDEKIPSDKEQWECLKSVLTSHFLVEAFPIWFF HPLCQKIGISYQVPFPKITDMLIQWAVFFVLEDTWHYWFHRGLHYGVFYKYIHKQHHRYA APFGLAAEYAHPVEVALLGLGTVGIPIVWCLITGNLHLFTVSIWIILRLFQAVDAHSGYE FPWSLHNFLPFWAGADHHDEHHHYFIGGYSSSFRWWDFILDTEAGPKAKKGREDKVKQNV EKLQKKNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF740 conjugate, 0.1mg/mL
BNC740667-100 1x 100 µL

CD1a (O10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF740 conjugate, 0.1mg/mL
BNC742957-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details