Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii Uncharacterized protein PH0614 (PH0614)

This Recombinant Pyrococcus horikoshii Uncharacterized protein PH0614 (PH0614) spans the amino acid sequence from region 24-332.

Product Specifications

Product Name Alternative

Uncharacterized protein PH0614

UniProt

O58348

Expression Region

24-332

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

INDNYDLIIVRNDDLIDYLISLPYSHLINAPILPVNPKELDPVTKAQLYSYIQLGRDKVL IIGNTNAVSLDVEKELRDMGFSVTRIGGADRAETAEKLALHFYQNGSKVVILASAWDYGS TLAAAEFAMEYKCPILLTWENQLSPSALRGIEKLNAKIVILVGFGINETIEKTLEGMGYE TYWIGRDIEPPPIETTTSSPPQSSGSKSFFLGMIVTLIILAPVILYLWRRRSERMSEFLE QFNEKELAVLKAIMERGGEVKQEDLPRIVGYSRPTISRIVQDLEKKGIVEREKSGKTFIV RVIKKIKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GSG1 activation kit by CRISPRa
GA113169 1 Kit

Human GSG1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant SERPING1 Antibody
RC-15024-01 50 μL

Recombinant SERPING1 Antibody

Sign In for Pricing
View Details
Recombinant SERPING1 Antibody
RC-15024-02 100 µL

Recombinant SERPING1 Antibody

Sign In for Pricing
View Details
Recombinant SERPING1 Antibody
RC-15024-03 1 mL

Recombinant SERPING1 Antibody

Sign In for Pricing
View Details
Ethyl 3-(1,3-Dioxolane)hexanoate
TRC-E917075-2G 2 g

Ethyl 3-(1,3-Dioxolane)hexanoate

Sign In for Pricing
View Details
Recombinant Human NEDD8
PKSH034041-01 10 µg

Recombinant Human NEDD8

Sign In for Pricing
View Details