Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii Uncharacterized protein PH0614 (PH0614)

This Recombinant Pyrococcus horikoshii Uncharacterized protein PH0614 (PH0614) spans the amino acid sequence from region 24-332.

Product Specifications

Product Name Alternative

Uncharacterized protein PH0614

UniProt

O58348

Expression Region

24-332

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

INDNYDLIIVRNDDLIDYLISLPYSHLINAPILPVNPKELDPVTKAQLYSYIQLGRDKVL IIGNTNAVSLDVEKELRDMGFSVTRIGGADRAETAEKLALHFYQNGSKVVILASAWDYGS TLAAAEFAMEYKCPILLTWENQLSPSALRGIEKLNAKIVILVGFGINETIEKTLEGMGYE TYWIGRDIEPPPIETTTSSPPQSSGSKSFFLGMIVTLIILAPVILYLWRRRSERMSEFLE QFNEKELAVLKAIMERGGEVKQEDLPRIVGYSRPTISRIVQDLEKKGIVEREKSGKTFIV RVIKKIKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TIAM1-AS1 activation kit by CRISPRa
GA115729 1 Kit

Human TIAM1-AS1 activation kit by CRISPRa

Sign In for Pricing
View Details
UPK3A (Uroplakin 3A) (Rabbit PAb), CF640R conjugate, 0.1mg/mL
BNC400409-100 1x 100 µL

UPK3A (Uroplakin 3A) (Rabbit PAb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/3156R), Biotin conjugate, 0.1mg/mL
BNCB3156-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/3156R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ceramide glucosyltransferase (UGCG) Rabbit Polyclonal Antibody
TA368814 100 µL

Ceramide glucosyltransferase (UGCG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI3E7]
CF805649 100 µg

PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI3E7]

Sign In for Pricing
View Details
Trap1 Antibody: APC
SMC-207D-APC 100 µg

Trap1 Antibody: APC

Sign In for Pricing
View Details