Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii Uncharacterized protein PH0614 (PH0614)

This Recombinant Pyrococcus horikoshii Uncharacterized protein PH0614 (PH0614) spans the amino acid sequence from region 24-332.

Product Specifications

Product Name Alternative

Uncharacterized protein PH0614

UniProt

O58348

Expression Region

24-332

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

INDNYDLIIVRNDDLIDYLISLPYSHLINAPILPVNPKELDPVTKAQLYSYIQLGRDKVL IIGNTNAVSLDVEKELRDMGFSVTRIGGADRAETAEKLALHFYQNGSKVVILASAWDYGS TLAAAEFAMEYKCPILLTWENQLSPSALRGIEKLNAKIVILVGFGINETIEKTLEGMGYE TYWIGRDIEPPPIETTTSSPPQSSGSKSFFLGMIVTLIILAPVILYLWRRRSERMSEFLE QFNEKELAVLKAIMERGGEVKQEDLPRIVGYSRPTISRIVQDLEKKGIVEREKSGKTFIV RVIKKIKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPK1 (N-term) Rabbit Polyclonal Antibody
AP54344PU-N 400 µL

TPK1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
Mouse Prox1 activation kit by CRISPRa
GA203405 1 Kit

Mouse Prox1 activation kit by CRISPRa

Sign In for Pricing
View Details
HPGDS Antibody
KC-8354-01 50 μL

HPGDS Antibody

Sign In for Pricing
View Details