Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii UPF0252 protein PH0672 (PH0672)

This Recombinant Pyrococcus horikoshii UPF0252 protein PH0672 (PH0672) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

UPF0252 protein PH0672

UniProt

O58405

Expression Region

1-309

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKVSVIIFIVIMLGIGCLNLNESIKETCPRTSNITQAMSCYIPEDFEILKGVAEEIPGG TIEWKIWNILEWEEDHLSYDNNKGSDIILKPSEFIKVGEGVCTDYAVLTAGLLLASNISP VYLMIFHFMEDPTLHAAVAVNISGKLFILDQRLPPKNLDSYLIQFSKLEGKIILFAEMYK VEMKKGRVVVSGRKYLDLSNFGFYPGNISLDMLENLLLSEFQRRTNLFPRIDLKTVLPQG LKERKVWMIKFENFKLFYDDTFVEQYSNFIADEILKNEKIKSDISRYSAFWISIKLEGDD LIVRLFLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPYL1 sgRNA CRISPR Lentivector set (Human)
K2543701 3x 1.0 µg

TSPYL1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
TGFβ/SMAD luciferase reporter lentivirus (Hyg) - TGFβ/SMAD luciferase reporter lentivirus (Hyg)
GTR15424894 25 µL (1x 25 µL)

TGFβ/SMAD luciferase reporter lentivirus (Hyg) - TGFβ/SMAD luciferase reporter lentivirus (Hyg)

Sign In for Pricing
View Details
Compound NP-012191
MBS5794976 Inquire

Compound NP-012191

Sign In for Pricing
View Details
Von Willebrand Factor (VWF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D4]
TA803310BM 100 µL

Von Willebrand Factor (VWF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D4]

Sign In for Pricing
View Details
Atp13a3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4755704 1.0 µg DNA

Atp13a3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse SIRT6 shRNA Plasmid
abx974095-01 150 µg

Mouse SIRT6 shRNA Plasmid

Sign In for Pricing
View Details