Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii UPF0252 protein PH0672 (PH0672)

This Recombinant Pyrococcus horikoshii UPF0252 protein PH0672 (PH0672) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

UPF0252 protein PH0672

UniProt

O58405

Expression Region

1-309

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKVSVIIFIVIMLGIGCLNLNESIKETCPRTSNITQAMSCYIPEDFEILKGVAEEIPGG TIEWKIWNILEWEEDHLSYDNNKGSDIILKPSEFIKVGEGVCTDYAVLTAGLLLASNISP VYLMIFHFMEDPTLHAAVAVNISGKLFILDQRLPPKNLDSYLIQFSKLEGKIILFAEMYK VEMKKGRVVVSGRKYLDLSNFGFYPGNISLDMLENLLLSEFQRRTNLFPRIDLKTVLPQG LKERKVWMIKFENFKLFYDDTFVEQYSNFIADEILKNEKIKSDISRYSAFWISIKLEGDD LIVRLFLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC22D1 Antibody / TSC22
orb1151589-01 20 µg

TSC22D1 Antibody / TSC22

Sign In for Pricing
View Details
TSC22D1 Antibody / TSC22
orb1151589-02 100 µg

TSC22D1 Antibody / TSC22

Sign In for Pricing
View Details
MIR7243 Mouse qPCR Template Standard (MI0025043)
MK301120 200 Reactions

MIR7243 Mouse qPCR Template Standard (MI0025043)

Sign In for Pricing
View Details
Lentiviral mouse Mrpl14 shRNA (UAS) - Lentiviral mouseMrpl14 shRNA (UAS, GFP) (25)
GTR15210008 1 Vial

Lentiviral mouse Mrpl14 shRNA (UAS) - Lentiviral mouseMrpl14 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TRAF6 Protein, Human, Recombinant (His & SUMO)
TMPH-02210-01 5 µg

TRAF6 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
TRAF6 Protein, Human, Recombinant (His & SUMO)
TMPH-02210-02 10 µg

TRAF6 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details