Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis Uncharacterized protein CT_474 (CT_474)

This Recombinant Chlamydia trachomatis Uncharacterized protein CT_474 (CT_474) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Uncharacterized protein CT_474

UniProt

O84480

Expression Region

1-309

Origin

Chlamydia trachomatis (strain D/UW-3/Cx)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIEGRGSGAMQSKKTIKWLKQALVLSSIVNILLLLLIYSTVFRKDIYKLRVFPGNLIAK SSRIGKIPEDILERLENASFADLLALLQEERMVFGHPLKSWALGVSIQKYFVDIAPMLTH PLTFIRLKSPERTWLLPDINDQEFTRICQYLLTERFPFSSRGFFRIMVRDCEAGMVDEDV LYRFCHLPEFLYVRSLLFGAEIEAASVASLARMIIQGGEDLFFSLCCLENRQTAISDHQR RCFLKAYVDRQEPLAALLLLVHDADWVLHEFSDSDLQSFIQLLPREAHYTKKFLGCVAQS CRLGILLEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NMDAR2B Antibody (2G5)
H00002904-M01 0.1 mg

Mouse Monoclonal NMDAR2B Antibody (2G5)

Sign In for Pricing
View Details
Gria1 (NM_008165) Mouse Tagged ORF Clone
MG211142 10 µg

Gria1 (NM_008165) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
AURKC Protein Vector (Rat) (pPM-C-HA)
12872026 500 ng

AURKC Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Human CD192/CCR2 Antibody (1D9), APC
MBS1584183-01 50 Tests

Anti-Human CD192/CCR2 Antibody (1D9), APC

Sign In for Pricing
View Details
Anti-Human CD192/CCR2 Antibody (1D9), APC
MBS1584183-02 100 Tests

Anti-Human CD192/CCR2 Antibody (1D9), APC

Sign In for Pricing
View Details
Anti-Human CD192/CCR2 Antibody (1D9), APC
MBS1584183-03 5x 100 Tests

Anti-Human CD192/CCR2 Antibody (1D9), APC

Sign In for Pricing
View Details