Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis Uncharacterized protein CT_474 (CT_474)

This Recombinant Chlamydia trachomatis Uncharacterized protein CT_474 (CT_474) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Uncharacterized protein CT_474

UniProt

O84480

Expression Region

1-309

Origin

Chlamydia trachomatis (strain D/UW-3/Cx)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIEGRGSGAMQSKKTIKWLKQALVLSSIVNILLLLLIYSTVFRKDIYKLRVFPGNLIAK SSRIGKIPEDILERLENASFADLLALLQEERMVFGHPLKSWALGVSIQKYFVDIAPMLTH PLTFIRLKSPERTWLLPDINDQEFTRICQYLLTERFPFSSRGFFRIMVRDCEAGMVDEDV LYRFCHLPEFLYVRSLLFGAEIEAASVASLARMIIQGGEDLFFSLCCLENRQTAISDHQR RCFLKAYVDRQEPLAALLLLVHDADWVLHEFSDSDLQSFIQLLPREAHYTKKFLGCVAQS CRLGILLEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fnbp1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4759306 1.0 µg DNA

Fnbp1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
IGFL4 Rabbit Polyclonal Antibody (BF488)
orb2504768 100 µL

IGFL4 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Adgre4 Mouse shRNA Plasmid (Locus ID 52614)
TR516750 1 Kit

Adgre4 Mouse shRNA Plasmid (Locus ID 52614)

Sign In for Pricing
View Details
W/W042/NT/PE-TRI12.5-81 Electrical & Equipment Safety Signs & Labels (Adhesive)
198397 81 Pack (81 Panel (s) x 1 Sheet)

W/W042/NT/PE-TRI12.5-81 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Rabbit Monoclonal IL-13R alpha 2 Antibody (15) [Allophycocyanin]
NBP2-90385APC 0.1 mL

Rabbit Monoclonal IL-13R alpha 2 Antibody (15) [Allophycocyanin]

Sign In for Pricing
View Details
CHIA Antibody
MBS8504070-01 0.1 mg

CHIA Antibody

Sign In for Pricing
View Details