Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe RING finger protein mug145 (mug145)

This Recombinant Schizosaccharomyces pombe RING finger protein mug145 (mug145) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

RING finger protein mug145, Meiotic expression up-regulated protein 34, Meiotically up-regulated gene 145 protein

UniProt

P87119

Expression Region

1-309

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIPKNRPMHVEEEVSSQTNTEILLFALVIILSVIFINFFFFYLCRCCVYFYHTLENQEG DDERPLIQHHMVNRSTGSLSPSVDRLGNVLGYDIPSRRRRSVVSKEALSCISLEIPYIKW LKKRKGHAKGESTFLDNRSENQSVIVQGQGETPSVIITYDVRRPNLGSTSFVEMSSALSN IYNTDASDGDSSDDSCLLEDEEDFCIICYADYAFDDILRVLPCEHVFHTQCIDTWMTTMK ASCPLCNEDYYKYFLQMDAASSVTHENAAWSIPLSPGDSRTHSAETDRSLLSAMSVRNSR MPYIVSSTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-100 1x 100 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-500 1x 500 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
BNC942853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/991 + SOX10/1074), CF488A conjugate, 0.1mg/mL
BNC881074-100 1x 100 µL

SOX10 (SOX10/991 + SOX10/1074), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF594 conjugate, 0.1mg/mL
BNC941880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details