Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

P46482

Expression Region

1-310

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-500 1x 500 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-100 1x 100 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-100 1x 100 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details