Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0508 (Mb0508)

This Recombinant Uncharacterized protein Mb0508 (Mb0508) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0508

UniProt

P64716

Expression Region

1-310

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGPHPETESSGNRQISVAELLARQGVTGAPARRRRRRRGDSDAITVAELTGEIPIIRDD HHHAGPDAHASQSPAANGRVQVGEAAPQSPAEPVAEQVAEEPTRTVYWSQPEPRWPKSPP QDRRESGPELSEYPRPLRHTHSDRAPAGPPSGAEHMSPDPVEHYPDLWVDVLDTEVGEAE AETEVREAQPGRGERHAAAAAAGTDVEGDGAAEARVARRALDVVPTLWRGALVVLQSILA VAFGAGLFIAFDQLWRWNSIVALVLSVMVILGLVVSVRAVRKTEDIASTLIAVAVGALIT LGPLALLQSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isocitric acid lactone
sc-235404 1 g

Isocitric acid lactone

Sign In for Pricing
View Details
MUL1 Rabbit Polyclonal Antibody
orb1799-01 50 μL

MUL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MUL1 Rabbit Polyclonal Antibody
orb1799-02 100 µL

MUL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MUL1 Rabbit Polyclonal Antibody
orb1799-03 200 µL

MUL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLAM Family Member 6 (SLAMF6) Antibody (FITC)
abx337710-01 20 µg

SLAM Family Member 6 (SLAMF6) Antibody (FITC)

Sign In for Pricing
View Details
SLAM Family Member 6 (SLAMF6) Antibody (FITC)
abx337710-02 50 µg

SLAM Family Member 6 (SLAMF6) Antibody (FITC)

Sign In for Pricing
View Details