Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0508 (Mb0508)

This Recombinant Uncharacterized protein Mb0508 (Mb0508) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0508

UniProt

P64716

Expression Region

1-310

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGPHPETESSGNRQISVAELLARQGVTGAPARRRRRRRGDSDAITVAELTGEIPIIRDD HHHAGPDAHASQSPAANGRVQVGEAAPQSPAEPVAEQVAEEPTRTVYWSQPEPRWPKSPP QDRRESGPELSEYPRPLRHTHSDRAPAGPPSGAEHMSPDPVEHYPDLWVDVLDTEVGEAE AETEVREAQPGRGERHAAAAAAGTDVEGDGAAEARVARRALDVVPTLWRGALVVLQSILA VAFGAGLFIAFDQLWRWNSIVALVLSVMVILGLVVSVRAVRKTEDIASTLIAVAVGALIT LGPLALLQSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(4-Chloro-2,5-difluorophenyl) methanol
PC1024627 250 mg

(4-Chloro-2,5-difluorophenyl) methanol

Sign In for Pricing
View Details
IRS2 Recombinant Rabbit mAb
E43S47864 100 µL

IRS2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Anti-IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) Monoclonal Antibody (Clone: rIGHM/2558)
36-2557-100 100 µg

Anti-IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) Monoclonal Antibody (Clone: rIGHM/2558)

Sign In for Pricing
View Details
Rabbit Polyclonal Importin-9 Antibody
NB100-56489SS 0.025 mg

Rabbit Polyclonal Importin-9 Antibody

Sign In for Pricing
View Details
FGFR4 Human shRNA Plasmid Kit (Locus ID 2264)
TF320356 1 Kit

FGFR4 Human shRNA Plasmid Kit (Locus ID 2264)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YDR246W-A (YDR246W-A)
MBS1309633-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YDR246W-A (YDR246W-A)

Sign In for Pricing
View Details