Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant Enterobacter sp. p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

A4WF55

Expression Region

1-310

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLTRNISRTAITVALVILAFIAISRAWVFYTESPWTRDARFSADIVAIAPDVAGLITA VNVRDNQLVKKDQVLFTIDQPRYQKALEESEADVAYYQALTTEKRREAGRRNKLGIQAMS REEIDQSNNLLQTVLHQLAKAEATRDLAKLDLERTVIRAPSDGWVTNLNVYTGEFITRGS TAVALVKQHSFYVLAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSIAAGVTNSSATR DSKGMATVDSNLEWVRLAQRVPVRIRLDDEQGNLWPAGTTATVVITGEKDRNASNDSLFR KIAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duodenum Tumor Lysate
orb1672871 0.1 mg

Duodenum Tumor Lysate

Sign In for Pricing
View Details
APC Anti-Mouse/Human CD44 Antibody
JOT21189F 25μg

APC Anti-Mouse/Human CD44 Antibody

Sign In for Pricing
View Details
Ddx41 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
17842114 3x 1.0 µg

Ddx41 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CKMT2 Antibody (C-term)
MBS9209107-01 0.08 mL

CKMT2 Antibody (C-term)

Sign In for Pricing
View Details
CKMT2 Antibody (C-term)
MBS9209107-02 0.4 mL

CKMT2 Antibody (C-term)

Sign In for Pricing
View Details
CKMT2 Antibody (C-term)
MBS9209107-03 5x 0.4 mL

CKMT2 Antibody (C-term)

Sign In for Pricing
View Details