Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant Enterobacter sp. p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

A4WF55

Expression Region

1-310

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLTRNISRTAITVALVILAFIAISRAWVFYTESPWTRDARFSADIVAIAPDVAGLITA VNVRDNQLVKKDQVLFTIDQPRYQKALEESEADVAYYQALTTEKRREAGRRNKLGIQAMS REEIDQSNNLLQTVLHQLAKAEATRDLAKLDLERTVIRAPSDGWVTNLNVYTGEFITRGS TAVALVKQHSFYVLAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSIAAGVTNSSATR DSKGMATVDSNLEWVRLAQRVPVRIRLDDEQGNLWPAGTTATVVITGEKDRNASNDSLFR KIAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[Ile12, Val15] MUC5AC Analog 3 Peptide
abx266498-01 5 mg

[Ile12, Val15] MUC5AC Analog 3 Peptide

Sign In for Pricing
View Details
[Ile12, Val15] MUC5AC Analog 3 Peptide
abx266498-02 10 mg

[Ile12, Val15] MUC5AC Analog 3 Peptide

Sign In for Pricing
View Details
[Ile12, Val15] MUC5AC Analog 3 Peptide
abx266498-03 25 mg

[Ile12, Val15] MUC5AC Analog 3 Peptide

Sign In for Pricing
View Details
1,1'-(1,6-Hexanediyl)bis-piperidine Dihydrochloride
TRC-H444520-500MG 500 mg

1,1'-(1,6-Hexanediyl)bis-piperidine Dihydrochloride

Sign In for Pricing
View Details
NRN1 cDNA Clone
MBS1269422-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

NRN1 cDNA Clone

Sign In for Pricing
View Details
NRN1 cDNA Clone
MBS1269422-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

NRN1 cDNA Clone

Sign In for Pricing
View Details