Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant Enterobacter sp. p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

A4WF55

Expression Region

1-310

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLTRNISRTAITVALVILAFIAISRAWVFYTESPWTRDARFSADIVAIAPDVAGLITA VNVRDNQLVKKDQVLFTIDQPRYQKALEESEADVAYYQALTTEKRREAGRRNKLGIQAMS REEIDQSNNLLQTVLHQLAKAEATRDLAKLDLERTVIRAPSDGWVTNLNVYTGEFITRGS TAVALVKQHSFYVLAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSIAAGVTNSSATR DSKGMATVDSNLEWVRLAQRVPVRIRLDDEQGNLWPAGTTATVVITGEKDRNASNDSLFR KIAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDMA-BSA1
B12-Ag1 1 g

MDMA-BSA1

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri BEPA Polyclonal Antibody
MBS7161564 Inquire

Rabbit anti-Shigella flexneri BEPA Polyclonal Antibody

Sign In for Pricing
View Details
Mbtps1 (NM_053569) Rat Tagged ORF Clone Lentiviral Particle
RR204398L4V 200 µL

Mbtps1 (NM_053569) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human CCL16 (Chemokine C-C-Motif Ligand 16) ELISA Kit
MBS8804504-01 48 Well

Human CCL16 (Chemokine C-C-Motif Ligand 16) ELISA Kit

Sign In for Pricing
View Details
Human CCL16 (Chemokine C-C-Motif Ligand 16) ELISA Kit
MBS8804504-02 96 Well

Human CCL16 (Chemokine C-C-Motif Ligand 16) ELISA Kit

Sign In for Pricing
View Details
Human CCL16 (Chemokine C-C-Motif Ligand 16) ELISA Kit
MBS8804504-03 5x 96 Well

Human CCL16 (Chemokine C-C-Motif Ligand 16) ELISA Kit

Sign In for Pricing
View Details