Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant Citrobacter koseri p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

A8AQD5

Expression Region

1-310

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITN VSVHDNQLVKKDQILFTIDQPRYKKALEEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQHSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DAKGMATIDSNLEWVRLAQRVPVRIRLDDQQDNLWPAGTTATVVITGKQDRDETQDSFFR KMAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPJ Mouse Monoclonal Antibody [Clone ID: OTI3G8]
CF811852 100 µg

CENPJ Mouse Monoclonal Antibody [Clone ID: OTI3G8]

Sign In for Pricing
View Details
Anisole
TRC-A673900-500G 500 g

Anisole

Sign In for Pricing
View Details
FastClick™ XFD488 Azide
72735-AAT 1 mg

FastClick™ XFD488 Azide

Sign In for Pricing
View Details
SLC35A2 (NM_001282651) Human Tagged ORF Clone
RG238124 10 µg

SLC35A2 (NM_001282651) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS800973 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF810492 100 µg

AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI2D11]

Sign In for Pricing
View Details