Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant Citrobacter koseri p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

A8AQD5

Expression Region

1-310

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITN VSVHDNQLVKKDQILFTIDQPRYKKALEEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQHSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DAKGMATIDSNLEWVRLAQRVPVRIRLDDQQDNLWPAGTTATVVITGKQDRDETQDSFFR KMAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein A I (APOA1) (NM_000039) Human Over-expression Lysate
LC400009 20 µg

Apolipoprotein A I (APOA1) (NM_000039) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS501113 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI5B4]
CF807596 100 µg

NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI5B4]

Sign In for Pricing
View Details
Mouse Lilr4b activation kit by CRISPRa
GA201685 1 Kit

Mouse Lilr4b activation kit by CRISPRa

Sign In for Pricing
View Details
Rpl36a Mouse Gene Knockout Kit (CRISPR)
KN515043 1 Kit

Rpl36a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNAJB2 (NM_001039550) Human Over-expression Lysate
LC422070 20 µg

DNAJB2 (NM_001039550) Human Over-expression Lysate

Sign In for Pricing
View Details