Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Transmembrane protein 177 (tmem177)

This Recombinant Xenopus laevis Transmembrane protein 177 (tmem177) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Transmembrane protein 177

UniProt

Q66IS8

Expression Region

1-310

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSPFLWRFLSFTQKYRGTLLAVSSVGLFAANISYHVAPEQTFRKLYQGWSKGEPVQLTA KLQGLFQEVLEETHMGVTSSYVPFSAFGFHPVSAGIPWLPSGCLIGIPFNYNDTEQDGVG IADRVLLINGKEVDWSSDAGTHLRQALNLSLDAQKFSLAREVFYAQGNSPIIQASAAPVC LSGICLSSVAIKQLLGLYSGPILLRGVYNMAVVVLGFAGYFLCSDAVSQWLDYQSDRKVA AVSKSYATGGIEFYEKILAQNRILRTLMGKQGETMYSPSGNLFPNDYLRLKNAPYTSRRD RIKNALLQME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF740 conjugate, 0.1mg/mL
BNC741118-500 1x 500 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF594 conjugate, 0.1mg/mL
BNC940807-500 1x 500 µL

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF647 conjugate, 0.1mg/mL
BNC471725-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc Oncoprotein (MYC2895R), CF405S conjugate, 0.1mg/mL
BNC042895-100 1x 100 µL

C-Myc Oncoprotein (MYC2895R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details