Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 177 (tmem177)

This Recombinant Danio rerio Transmembrane protein 177 (tmem177) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Transmembrane protein 177

UniProt

Q6PBI8

Expression Region

1-310

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSRFLKISVFIQKYRTPLLLIGCGGVFSANIFYHIFPDHTYKKVYQAWHKGEPASLSEK LQNIFQEVLKDSSISTSGNFSAFAAFGFHPVGAGVPWLPSGAQIGIPANFNSSTADLEGI TNRTILINGKELEWDSDSGVALKNSLVFSLEAQKFAIAREVARLGSGGPILHAAVAPVCL AGACVYSVALKQIFRFQAGSIIFRGVVNLLSLGLGVMTYVLAADSVSQWLDYRSDRRAAG LSRDYAKGGLEFYEKILTRNKTLRSLMGQKGEEMYAPSGNLFPAHLLQLRHATYTSRRDR ILNLLKNENV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-500 1x 500 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-500 1x 500 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-500 1x 500 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details