Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Spermatid maturation protein 1 (Spem1)

This Recombinant Mouse Spermatid maturation protein 1 (Spem1) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Spermatid maturation protein 1

UniProt

Q5F289

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMAERPRPGWASYQNPNINNCQDMGNSILLLLGLIVCINIGINLVTLLWSRIRILLHRM FHIICEKETSTSLGKLVQPLRKQTYPKVHLRCTMDPVKMTVTPPPTRRRYRHRAPPSRRA RCPIAWAPDTDDEKPPHQHPAICSRHWNDSKDWEGFQSMQEVWEPWTQDGLEQPPQTIRF QPAVEARPLKSEIRSDQGLEAYVYTVNPPPPSPEALSHKNNAAGSGGCVEGEQAQGQPVS PSFLGPANVPEIPRRHSSGRIVYDARDVRRRLRELTQEVEALSHCYPLVSGSSAAEGTGK DWVYRPLKGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti AIFM1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120 ul
IRBAMLAIFM1AP123120UL 120 µL

Rabbit Anti AIFM1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120 ul

Sign In for Pricing
View Details
Disembodied Antibody Antigenic Blocking Peptide
MBS543590-01 0.25 mg

Disembodied Antibody Antigenic Blocking Peptide

Sign In for Pricing
View Details
Disembodied Antibody Antigenic Blocking Peptide
MBS543590-02 5x 0.25 mg

Disembodied Antibody Antigenic Blocking Peptide

Sign In for Pricing
View Details
ZNF740 siRNA Oligos set (Human)
51802171 3x 5 nmol

ZNF740 siRNA Oligos set (Human)

Sign In for Pricing
View Details
LAMC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1194808 1.0 µg DNA

LAMC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
FTHL16 AAV siRNA Pooled Vector
57702161 1.0 µg

FTHL16 AAV siRNA Pooled Vector

Sign In for Pricing
View Details