Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Spermatid maturation protein 1 (Spem1)

This Recombinant Mouse Spermatid maturation protein 1 (Spem1) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Spermatid maturation protein 1

UniProt

Q5F289

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMAERPRPGWASYQNPNINNCQDMGNSILLLLGLIVCINIGINLVTLLWSRIRILLHRM FHIICEKETSTSLGKLVQPLRKQTYPKVHLRCTMDPVKMTVTPPPTRRRYRHRAPPSRRA RCPIAWAPDTDDEKPPHQHPAICSRHWNDSKDWEGFQSMQEVWEPWTQDGLEQPPQTIRF QPAVEARPLKSEIRSDQGLEAYVYTVNPPPPSPEALSHKNNAAGSGGCVEGEQAQGQPVS PSFLGPANVPEIPRRHSSGRIVYDARDVRRRLRELTQEVEALSHCYPLVSGSSAAEGTGK DWVYRPLKGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CBX2  Rabbit Monoclonal Antibody
MA1663-.05 50 µL

Anti-CBX2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TNIK, NT (TRAF2 and NCK-interacting Kinase, KIAA0551) (Biotin)
MBS6503215-01 0.2 mL

TNIK, NT (TRAF2 and NCK-interacting Kinase, KIAA0551) (Biotin)

Sign In for Pricing
View Details
TNIK, NT (TRAF2 and NCK-interacting Kinase, KIAA0551) (Biotin)
MBS6503215-02 5x 0.2 mL

TNIK, NT (TRAF2 and NCK-interacting Kinase, KIAA0551) (Biotin)

Sign In for Pricing
View Details
Human ACSL5 Knockout A549 cell line
GTR15408978 1 Vial

Human ACSL5 Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant Mycobacterium marinum UvrABC system protein C (uvrC), partial
MBS1249514 Inquire

Recombinant Mycobacterium marinum UvrABC system protein C (uvrC), partial

Sign In for Pricing
View Details
Mouse Transmembrane Emp24 Domain Containing Protein 1 (TMED1) ELISA Kit
orb1947084-01 48 Tests

Mouse Transmembrane Emp24 Domain Containing Protein 1 (TMED1) ELISA Kit

Sign In for Pricing
View Details