Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Ubiquitin-associated domain-containing protein 2 (UBAC2)

This Recombinant Macaca fascicularis Ubiquitin-associated domain-containing protein 2 (UBAC2) spans the amino acid sequence from region 36-345.

Product Specifications

Product Name Alternative

Ubiquitin-associated domain-containing protein 2, UBA domain-containing protein 2, Phosphoglycerate dehydrogenase-like protein 1

UniProt

Q4R910

Expression Region

36-345

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HCQKLFVYDLHAVKNDFQIWRLICGRIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASF LLGSWVLSALFDFLLVEAMQYFFGITAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILG PLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYNSKMFQVHQVLCIPSWMAKFFS WTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINW NRLFPPLRQRQNVNYQGGRQSEPAAPPPLEVSEEQVARLMEMGFSRGDALEALRASNNDL NVATNFLLQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF488A conjugate, 0.1mg/mL
BNC882276-100 1x 100 µL

CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), CF740 conjugate, 0.1mg/mL
BNC740668-100 1x 100 µL

MART-1 / Melan-A (A103), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF740 conjugate, 0.1mg/mL
BNC741775-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details