Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Ubiquitin-associated domain-containing protein 2 (UBAC2)

This Recombinant Chicken Ubiquitin-associated domain-containing protein 2 (UBAC2) spans the amino acid sequence from region 35-344.

Product Specifications

Product Name Alternative

Ubiquitin-associated domain-containing protein 2, UBA domain-containing protein 2, Phosphoglycerate dehydrogenase-like protein 1

UniProt

Q5ZJQ8

Expression Region

35-344

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QHYQKFFAYNLQAIKEDFQIWRLVCGRVICLDLKDTFCSSLLIYNFRIFERRYGSRKFSS FLLGAWTLSALFDLLLVEAAQYVFGITINSLPSGFLGPVFALFVPFYCSIPRVQVTQVLG YFSITNKTLVYILGLQLLTSGSYIWILALSGLISGICYNSSILKVHRILCVPSWVAKIFS WTLEPIFSSAEPTNEIRVGMGATVDIQRQQRMELLDRQIMMSQVAQMRRQRQQQGGMINW NRLFPPLRHRHNENYQDHHPSDQDTPPPTEVSEEQVARLMEMGFSRGDALEALRASNNDL NVATNFLLQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-100 1x 100 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-100 1x 100 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-100 1x 100 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF488A conjugate, 0.1mg/mL
BNC881482-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF740 conjugate, 0.1mg/mL
BNC741959-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details