Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q83Q03

Expression Region

1-310

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSDLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-{[ (4-fluorophenyl) amino]carbonyl}pyrazine-2-carboxylic acid
sc-346122A 5 g

3-{[ (4-fluorophenyl) amino]carbonyl}pyrazine-2-carboxylic acid

Sign In for Pricing
View Details
DGKZ Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
18163065 1.0 µg DNA

DGKZ Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Ube2d2 3'UTR Lenti-reporter-Luc Vector
48957086 1.0 µg

Ube2d2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Chk2 T383 Rabbit Polyclonal Antibody
E53P02762 100 µL

Chk2 T383 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIGD5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46700111 3x 1.0 µg

TIGD5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Atl3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4614506 1.0 µg DNA

Atl3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details