Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q83Q03

Expression Region

1-310

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSDLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DCLRE1B antibody
PAab02267 100 µg

Anti-DCLRE1B antibody

Sign In for Pricing
View Details
Lentiviral mouse Pdxdc1 shRNA (UAS) - Lentiviral mouse Pdxdc1 shRNA (UAS) (25)
GTR15294164 1 Vial

Lentiviral mouse Pdxdc1 shRNA (UAS) - Lentiviral mouse Pdxdc1 shRNA (UAS) (25)

Sign In for Pricing
View Details
MYL6 (Myosin, Light Chain 6, alkali, Smooth Muscle and non-Muscle, ESMLC, LC17-GI, LC17-NM, LC17A, LC17B, MLC1SM, MLC3NM, MLC3SM) (PE)
MBS6184164-01 0.1 mL

MYL6 (Myosin, Light Chain 6, alkali, Smooth Muscle and non-Muscle, ESMLC, LC17-GI, LC17-NM, LC17A, LC17B, MLC1SM, MLC3NM, MLC3SM) (PE)

Sign In for Pricing
View Details
MYL6 (Myosin, Light Chain 6, alkali, Smooth Muscle and non-Muscle, ESMLC, LC17-GI, LC17-NM, LC17A, LC17B, MLC1SM, MLC3NM, MLC3SM) (PE)
MBS6184164-02 5x 0.1 mL

MYL6 (Myosin, Light Chain 6, alkali, Smooth Muscle and non-Muscle, ESMLC, LC17-GI, LC17-NM, LC17A, LC17B, MLC1SM, MLC3NM, MLC3SM) (PE)

Sign In for Pricing
View Details
RHBDD1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV656304 1.0 µg DNA

RHBDD1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Polyclonal SOX2 Antibody (C-term)
APR17864G 0.1ml

Polyclonal SOX2 Antibody (C-term)

Sign In for Pricing
View Details