Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q83Q03

Expression Region

1-310

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSDLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pd (II) meso-Tetra (N-Methyl-4-Pyridyl) Porphine Tetrachloride
sc-396935A 100 mg

Pd (II) meso-Tetra (N-Methyl-4-Pyridyl) Porphine Tetrachloride

Sign In for Pricing
View Details
SuLf2 (NM_001252578) Mouse Untagged Clone
MC229095 10 µg

SuLf2 (NM_001252578) Mouse Untagged Clone

Sign In for Pricing
View Details
FAIM3 Polyclonal Antibody, APC-Cy7 Conjugated
bs-20130R-APC-Cy7 100 µL

FAIM3 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Rad9, Phosphorylated (Ser272) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (Azide free) (HRP)
MBS6496456-01 0.2 mL

Rad9, Phosphorylated (Ser272) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (Azide free) (HRP)

Sign In for Pricing
View Details
Rad9, Phosphorylated (Ser272) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (Azide free) (HRP)
MBS6496456-02 5x 0.2 mL

Rad9, Phosphorylated (Ser272) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (Azide free) (HRP)

Sign In for Pricing
View Details
JAK3 shRNA (m) Lentiviral Particles
sc-35721-V 200 µL

JAK3 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details