Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q8FD50

Expression Region

1-310

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin (DES) Mouse Monoclonal Antibody [Clone ID: DES-82]
AM20619PU-N 100 µg

Desmin (DES) Mouse Monoclonal Antibody [Clone ID: DES-82]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121M-01 50 Tests

Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121M-02 100 Tests

Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
UNC13B Rabbit Polyclonal Antibody
TA365481 100 µL

UNC13B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-amino-3-hydroxybenzenesulfonamide
TRC-B406208-50MG 50 mg

4-amino-3-hydroxybenzenesulfonamide

Sign In for Pricing
View Details