Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q8FD50

Expression Region

1-310

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENO3 (NM_001976) Human Recombinant Protein
TP319257M 100 µg

ENO3 (NM_001976) Human Recombinant Protein

Sign In for Pricing
View Details
Human Relaxin 3 (RLN3) activation kit by CRISPRa
GA114648 1 Kit

Human Relaxin 3 (RLN3) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB530521 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Sodium Fluoroacetate
TRC-S960143-50MG 50 mg

Sodium Fluoroacetate

Sign In for Pricing
View Details
BST2 (NM_004335) Human Recombinant Protein
TP307540M 100 µg

BST2 (NM_004335) Human Recombinant Protein

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3082), CF740 conjugate, 0.1mg/mL
BNC743082-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/3082), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details