Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q8XF83

Expression Region

1-310

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nat3 (NM_008674) Mouse Tagged ORF Clone
MG216865 10 µg

Nat3 (NM_008674) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CETN3 Protein Vector (Mouse) (pPB-C-His)
PV164950 500 ng

CETN3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human Elafin ELISA Kit
orb340084-01 24 Tests

Human Elafin ELISA Kit

Sign In for Pricing
View Details
Human Elafin ELISA Kit
orb340084-02 48 Tests

Human Elafin ELISA Kit

Sign In for Pricing
View Details
Human Elafin ELISA Kit
orb340084-03 96 Tests

Human Elafin ELISA Kit

Sign In for Pricing
View Details
Human Elafin ELISA Kit
orb340084-04 5 x 96 T

Human Elafin ELISA Kit

Sign In for Pricing
View Details