Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q8XF83

Expression Region

1-310

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Melatonin Receptor 1B (MTNR1B)
FY-AB47783-01 1 mL

Anti-Melatonin Receptor 1B (MTNR1B)

Sign In for Pricing
View Details
Anti-Melatonin Receptor 1B (MTNR1B)
FY-AB47783-02 100 µL

Anti-Melatonin Receptor 1B (MTNR1B)

Sign In for Pricing
View Details
Anti-Melatonin Receptor 1B (MTNR1B)
FY-AB47783-03 200 µL

Anti-Melatonin Receptor 1B (MTNR1B)

Sign In for Pricing
View Details
FG-DN300PN100-PVC Flange Guards
311768 1 Pack (1 Piece (s) x 1 Pack)

FG-DN300PN100-PVC Flange Guards

Sign In for Pricing
View Details
IPO11 Antibody (N-term)
orb1928291-01 50 µL

IPO11 Antibody (N-term)

Sign In for Pricing
View Details
IPO11 Antibody (N-term)
orb1928291-02 100 µL

IPO11 Antibody (N-term)

Sign In for Pricing
View Details