Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus abyssi Uncharacterized protein PYRAB14350 (PYRAB14350)

This Recombinant Pyrococcus abyssi Uncharacterized protein PYRAB14350 (PYRAB14350) spans the amino acid sequence from region 24-333.

Product Specifications

Product Name Alternative

Uncharacterized protein PYRAB14350

UniProt

Q9UYS2

Expression Region

24-333

Origin

Pyrococcus abyssi (strain GE5 / Orsay)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AENGYDLIIVRNDDLIDYLIALPYSHLLDIPILPVNPKELDDVTKAQLYSYIQLGRDKIL IIGNNNAVSLNVEKELEDMGFKVTRIGGADRTETAEKLALHFYPNGSKLVILASAWDYGS TLAASEFAMEYKCPILLTWENQLSPSALEGIKKLNPKIVILVGFGINETVEKTIEDMGYE TYWIGRDIEPPPIETTTTTTPNQTSSSKSFFLGVLVTLMILSPVIVYLWKKREERRSQFL EQFSEKEIEVLRAIIENGGEIKQEELPKIVGYSRPTISRIIQDLEKKGIVEREKSGKTFI VRVIKKIKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPED1 Human Gene Knockout Kit (CRISPR)
KN417158 1 Kit

CPED1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human NECTIN4/Nectin 4 protein (His tag)
PDMH100416-01 20 µg

Recombinant Human NECTIN4/Nectin 4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4/Nectin 4 protein (His tag)
PDMH100416-02 100 µg

Recombinant Human NECTIN4/Nectin 4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4/Nectin 4 protein (His tag)
PDMH100416-03 500 µg

Recombinant Human NECTIN4/Nectin 4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4/Nectin 4 protein (His tag)
PDMH100416-04 1 mg

Recombinant Human NECTIN4/Nectin 4 protein (His tag)

Sign In for Pricing
View Details
Hspa14 (NM_015765) Mouse Over-expression Lysate
LC708190 20 µg

Hspa14 (NM_015765) Mouse Over-expression Lysate

Sign In for Pricing
View Details