Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:1b p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant Yersinia pseudotuberculosis serotype O:1b p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

A7FDT5

Expression Region

1-311

Origin

Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTE VPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQREFSRRHLLGIQALS QEEIDQASNVLQTVQHQLAKTIAVRNLARLDLERTTIRAPAEGWVTNLNVHAGEFINRGA TAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSA DSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPM TKLMHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF594 conjugate, 0.1mg/mL
BNC942651-100 1x 100 µL

Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-100 1x 100 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-100 1x 100 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (SPN/839), CF594 conjugate, 0.1mg/mL
BNC940839-100 1x 100 µL

CD43 (SPN/839), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF568 conjugate, 0.1mg/mL
BNC681133-500 1x 500 µL

CD74 (CLIP/1133), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details