Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coccidioides posadasii Probable endonuclease LCL3 (LCL3)

This Recombinant Coccidioides posadasii Probable endonuclease LCL3 (LCL3) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Probable endonuclease LCL3, EC= 3.1.-.-

UniProt

C5P0Z4

Expression Region

1-311

Origin

Coccidioides posadasii (strain C735) (Valley fever fungus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWLFWASPPQDDSNSNSGAASQVKCRNNENVDVPAPSNAAPPSDRTISKVQSSSRDWNS IVNATDWKQFTEPRTIIPTALVTGGILLCVHIHRKYLRRIPEAGHISPSFFRRRSLLGKV TSVGDGDNFRMYHTPGGKLGGWEWWRKVPTGKNELKNRTIHVRLAGVDAPELPHFGRPAQ PFSQEAHSWLTNYILGRRVRAHLYRPDQYGRVVATVYVRRWLFFRQDVGLQMLKHGLATV YEAKTGVEFGGVELERQYREAEACAKKKGKGMWKALKGGTKGEWESPREYKTRMAAEEGQ KKNARGITRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
BNC940031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF568 conjugate, 0.1mg/mL
BNC682462-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details