Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized 34.8 kDa protein in hlyA 3'region

This Recombinant Uncharacterized 34.8 kDa protein in hlyA 3'region spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Uncharacterized 34.8 kDa protein in hlyA 3'region

UniProt

Q47877

Expression Region

1-311

Origin

Edwardsiella tarda

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAYSYMLIKNPDVNFEGITINGYVDLPGRIVQDQKNARSHAVTWDTKVKKQLLDTLNGI VEYDTTFDNYYETMVEAINTGDGETLKEGITDLRGEIQQNQKYAQQLIEELTKLRDSIGH DVRAFGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYYKQLESDGFNVMKGAILGLPI IGGIIVGVARDNLGKLEPLLAELRQTVDYKVTLNRVVGVAYSNINEIDKALDDAINALTY MSTQWHDLDSQYSGVLGHIENAAQKADQNKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIK ELKVETVTPQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to TLR6 (Clone: ABM1B50)
10-3002-100 100 µg

Monoclonal Antibody to TLR6 (Clone: ABM1B50)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS627414 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Recombinant GCSH Antibody
RN-14738-01 50 μL

Recombinant GCSH Antibody

Sign In for Pricing
View Details
Recombinant GCSH Antibody
RN-14738-02 100 µL

Recombinant GCSH Antibody

Sign In for Pricing
View Details
Recombinant GCSH Antibody
RN-14738-03 1 mL

Recombinant GCSH Antibody

Sign In for Pricing
View Details
Tide Quencher™ 7.1WS maleimide [TQ7.1WS maleimide]
2118-AAT 1 mg

Tide Quencher™ 7.1WS maleimide [TQ7.1WS maleimide]

Sign In for Pricing
View Details